General Information

  • ID:  hor002256
  • Uniprot ID:  O02036
  • Protein name:  Leucokinin-1
  • Gene name:  AAEL010172
  • Organism:  Aedes aegypti (Yellowfever mosquito) (Culex aegypti)
  • Family:  Kinin family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Stegomyia (subgenus), Aedes (genus), Aedini (tribe), Culicinae (subfamily), Culicidae (family), Culicoidea (superfamily), Culicomorpha (infraorder), Nematocera (suborder), Diptera (order), Endopterygota (cohort), Neoptera (infraclass), Pterygota (subclass), Dicondylia, Insecta (class), Hexapoda (subphylum), Pancrustacea, Mandibulata, Arthropoda (phylum), Panarthropoda, Ecdysozoa, Protostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0007218 neuropeptide signaling pathway
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  NSKYVSKQKFYSWG
  • Length:  14(167-180)
  • Propeptide:  MAMLLQVALPLLAAVSWGWELNENDDSLAKIIEGCEWTSRQNVISEILLDRYRKYAMYNFFLLDDVCAVHEWNKNLKEPEFSENNEAEDKSPTSAQNTQEHIPGNNFPPPAASNPPVNSSCAKSAKDFFICLSNQLGDPTLNAMLLDNLEVACDPRFSPVSAIQKRNSKYVSKQKFYSWGGKRNNPNVFYPWGGKRNTGRVHRQPKVVIRNPFHAWGGKRNQKDDNVF
  • Signal peptide:  MAMLLQVALPLLAAVSWG
  • Modification:  T14 Glycine amide
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Stimulates both fluid secretion by the Malpighian tubules and hindgut contractions. Depolarize the transepithelial voltage of the Malpighian tubules in concentrations of less than 10(-9) M and increase the frequency of hindgut contractions at concentratio
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-O02036-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor002256_AF2.pdbhor002256_ESM.pdb

Physical Information

Mass: 195397 Formula: C81H116N20O22
Absent amino acids: ACDEHILMPRT Common amino acids: KS
pI: 10.33 Basic residues: 3
Polar residues: 7 Hydrophobic residues: 3
Hydrophobicity: -128.57 Boman Index: -2902
Half-Life: 1.4 hour Half-Life Yeast: 3 min
Half-Life E.Coli: >10 hour Aliphatic Index 20.71
Instability Index: 4143.57 Extinction Coefficient cystines: 8480
Absorbance 280nm: 652.31

Literature

  • PubMed ID:  8048942
  • Title:  Isolation and Identification of Three Leucokinins From the Mosquito Aedes Aegypti